PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.X5BXA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family ZF-HD
Protein Properties Length: 85aa    MW: 9311.47 Da    PI: 8.6179
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.X5BXAgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer105.63e-331773360
  ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                 +vrY eC+kNhAa++Gg+avDGC+Efm+s   egt+ al+CaACgCHRnFHRrev++e
  Araip.X5BXA 17 NVRYGECQKNHAANIGGYAVDGCREFMAS-AGEGTSGALTCAACGCHRNFHRREVQTE 73
                 79**************************9.6668********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257748.0E-29182IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.1E-301770IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.9E-261970IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.4852069IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048509Biological Processregulation of meristem development
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
MKKRQVAVKT SSTVIRNVRY GECQKNHAAN IGGYAVDGCR EFMASAGEGT SGALTCAACG  60
CHRNFHRREV QTEVVCEYSP PHHQN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016193219.13e-58PREDICTED: mini zinc finger protein 3-like
SwissprotQ2Q4939e-40MIF3_ARATH; Mini zinc finger protein 3
TrEMBLG7IXD41e-51G7IXD4_MEDTR; Mini zinc finger protein
STRINGGLYMA04G33640.12e-47(Glycine max)
STRINGGLYMA06G20810.12e-47(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF155034100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18835.15e-41mini zinc finger